Cytochrome C Oxidase Subunit 1, Recombinant, Human, aa474-513, His-GST-Tag

Catalog Number: USB-584144
Article Name: Cytochrome C Oxidase Subunit 1, Recombinant, Human, aa474-513, His-GST-Tag
Biozol Catalog Number: USB-584144
Supplier Catalog Number: 584144
Alternative Catalog Number: USB-584144-20,USB-584144-100
Manufacturer: US Biological
Category: Molekularbiologie
Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B. Source: Recombinant protein corresponding to aa474-513 from human Cytochrome c oxidase subunit 1, fused to His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~36.3kD Amino Acid Sequence: EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36.3
UniProt: P00395
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.