Cytokine Receptor Common Subunit Gamma, Recombinant, Human, aa56-254, His-Tag

Catalog Number: USB-584158
Article Name: Cytokine Receptor Common Subunit Gamma, Recombinant, Human, aa56-254, His-Tag
Biozol Catalog Number: USB-584158
Supplier Catalog Number: 584158
Alternative Catalog Number: USB-584158-20,USB-584158-100
Manufacturer: US Biological
Category: Molekularbiologie
Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15. Recombinant protein corresponding to aa56-254 from human Cytokine receptor common subunit gamma, fused to 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~25.0kD Amino Acid Sequence: PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25
UniProt: P31785
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.