Cytokine-like Protein 1, Recombinant, Human, aa23-136, His-Tag, Myc-Tag

Catalog Number: USB-584163
Article Name: Cytokine-like Protein 1, Recombinant, Human, aa23-136, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584163
Supplier Catalog Number: 584163
Alternative Catalog Number: USB-584163-20,USB-584163-100,USB-584163-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa23-136 from human Cytokine-like protein 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~20.8kD Amino Acid Sequence: TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.8
UniProt: Q9NRR1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.