Cytolethal Distending Toxin Subunit A, Recombinant, E. coli, aa22-258, His-Tag

Catalog Number: USB-584164
Article Name: Cytolethal Distending Toxin Subunit A, Recombinant, E. coli, aa22-258, His-Tag
Biozol Catalog Number: USB-584164
Supplier Catalog Number: 584164
Alternative Catalog Number: USB-584164-20,USB-584164-100
Manufacturer: US Biological
Category: Molekularbiologie
CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB. Source: Recombinant protein corresponding to aa22-258 from Escherichia coli Cytolethal distending toxin subunit A, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~29.5kD Amino Acid Sequence: CSSGKNKAYLDPKVFPPQVEGGPTVPSPDEPGLPLPGPGPALPTNGAIPIPEPGTAPAVSLMNMDGSVLTMWSRGAGSSLWAYYIGDSNSFGELRNWQIMPGTRPNTIQFRNVDVGTCMTSFPGFKGGVQLSTAPCKFGPERFDFQPMATRNGNYQLKSLSTGLCIRANFLGRTPSSPYATTLTMERCPSSGEKNFEFMWSISEPLRPALATIAKPEIRPFPPQPIEPDEHSTGGEQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.5
UniProt: Q46668
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.