Cytotoxin 2, Recombinant, Naja atra, aa22-81, His-Tag, Myc-Tag

Catalog Number: USB-584172
Article Name: Cytotoxin 2, Recombinant, Naja atra, aa22-81, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584172
Supplier Catalog Number: 584172
Alternative Catalog Number: USB-584172-20,USB-584172-100
Manufacturer: US Biological
Category: Molekularbiologie
Basic protein that binds to cell membrane and depolarizes cardiomyocytes. It also shows lytic activities, but 2-fold less important than that of CTX-A4. It binds to the integrin alpha-V/beta-3 (ITGAV/ITGB3) with a moderate affinity. It may interact with sulfatides in the cell membrane which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induce mitochondrial swelling and fragmentation. Source: Recombinant protein corresponding to aa22-81 from Naja atra Cytotoxin 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~14.2kD Amino Acid Sequence: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.2
UniProt: P01442
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.