Defensin-1, Recombinant, Apis Mellifera Carnica, aa44-94, His-KSI-Tag

Catalog Number: USB-584191
Article Name: Defensin-1, Recombinant, Apis Mellifera Carnica, aa44-94, His-KSI-Tag
Biozol Catalog Number: USB-584191
Supplier Catalog Number: 584191
Alternative Catalog Number: USB-584191-20,USB-584191-100
Manufacturer: US Biological
Category: Molekularbiologie
Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration. Source: Recombinant protein corresponding to aa44-94 from Apis mellifera carnica Defensin-1, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.9kD Amino Acid Sequence: VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.9
UniProt: Q5J8R1
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.