Dense Granule Protein 3, Recombinant, Toxoplasma gondii, aa43-114, His-Tag
Biozol Catalog Number:
USB-584213
Supplier Catalog Number:
584213
Alternative Catalog Number:
USB-584213-20,USB-584213-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM. Source: Recombinant protein corresponding to aa43-114 from Toxoplasma gondii Dense granule protein 3, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~10.8kD Amino Acid Sequence: ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted