Dihydrolipoyl Dehydrogenase, Recombinant, Hymenolepis Diminuta, aa1-53, His-Tag, Myc-Tag

Catalog Number: USB-584246
Article Name: Dihydrolipoyl Dehydrogenase, Recombinant, Hymenolepis Diminuta, aa1-53, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584246
Supplier Catalog Number: 584246
Alternative Catalog Number: USB-584246-20,USB-584246-100
Manufacturer: US Biological
Category: Molekularbiologie
Lipoamide dehydrogenase is a component of the glycine cleavage system as well as of the alpha-ketoacid dehydrogenase complexes. This enzyme has lipoamide dehydrogenase activity and NADH -> NAD transhydrogenation activity. Also displays some NADH-ferricyanide reductase and NADPH -> NAD transydrogenation activities. Source: Recombinant protein corresponding to aa1-53 from Hymenolepis diminuta Dihydrolipoyl dehydrogenase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~10.3kD Amino Acid Sequence: LSSGEKDLVVIGSGPGGYVAAIKAAQLGMLTVCIEKYPTFGGTCLNVGCIPSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 10.3
UniProt: P80647
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.