Disco-interacting Protein 2 Homolog A, Recombinant, Human, aa9-127, His-Tag

Catalog Number: USB-584260
Article Name: Disco-interacting Protein 2 Homolog A, Recombinant, Human, aa9-127, His-Tag
Biozol Catalog Number: USB-584260
Supplier Catalog Number: 584260
Alternative Catalog Number: USB-584260-20
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the de novo synthesis of acetyl-CoA in vitro. Promotes acetylation of CTTN, possibly by providing the acetyl donor, ensuring correct dendritic spine morphology and synaptic transmission. Binds to follistatin-related protein FSTL1 and may act as a cell surface receptor for FSTL1, contributing to AKT activation and subsequent FSTL1-induced survival and function of endothelial cells and cardiac myocytes. Source: Recombinant protein corresponding to aa9-127 from human Disco-interacting protein 2 homolog A, fused to 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~18.9kD Amino Acid Sequence: EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.9
UniProt: Q14689
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.