Disco-interacting Protein 2 Homolog C, Recombinant, Human, aa1-125, His-Tag
Biozol Catalog Number:
USB-584262
Supplier Catalog Number:
584262
Alternative Catalog Number:
USB-584262-20
Manufacturer:
US Biological
Category:
Molekularbiologie
Source: Recombinant protein corresponding to aa1-125 from human Disco-interacting protein 2 homolog C, fused to 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~19kD Amino Acid Sequence: MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted