Ditrans, Polycis-undecaprenyl-diphosphate Synthase ((2E,6E)-farnesyl-diphosphate specific), Recombinant, E. coli, aa1-253, His-Tag

Product Overview

• Article Name: Ditrans, Polycis-undecaprenyl-diphosphate Synthase ((2E,6E)-farnesyl-diphosphate specific), Recombinant, E. coli, aa1-253, His-Tag
• Biozol Catalog Number: USB-584265
• Supplier Catalog Number: 584265
• Alternative Catalog Number: USB-584265-20,USB-584265-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Generates ditrans,octacis-undecaprenyl pyrophosphate (UPP) from isopentenyl pyrophosphate (IPP) and farnesyl diphosphate (FPP). UPP is the precursor of glycosyl carrier lipid in the biosynthesis of bacterial cell wall polysaccharide components such as peptidoglycan and lipopolysaccharide. Source: Recombinant protein corresponding to aa1-253 from Escherichia coli Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific), fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.4kD Amino Acid Sequence: MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 32.4
• UniProt: P60472
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.