DNA-binding Protein H-NS, Recombinant, SerRatia marcescens, aa2-135, His-Tag
Biozol Catalog Number:
USB-584283
Supplier Catalog Number:
584283
Alternative Catalog Number:
USB-584283-20,USB-584283-100
Manufacturer:
US Biological
Category:
Molekularbiologie
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. Source: Recombinant protein corresponding to aa2-135 from SerRatia marcescens DNA-binding protein H-NS, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.5kD Amino Acid Sequence: SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted