DNA-binding Protein H-NS, Recombinant, SerRatia marcescens, aa2-135, His-Tag

Product Overview

• Article Name: DNA-binding Protein H-NS, Recombinant, SerRatia marcescens, aa2-135, His-Tag
• Biozol Catalog Number: USB-584284
• Supplier Catalog Number: 584284
• Alternative Catalog Number: USB-584284-20,USB-584284-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. Source: Recombinant protein corresponding to aa2-135 from SerRatia marcescens DNA-binding protein H-NS, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.5kD Amino Acid Sequence: SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 17.5
• UniProt: P18955
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.