DNA-binding Protein HMf-2, Recombinant, Methanothermus fervidus, aa1-69, His-Tag

Product Overview

• Article Name: DNA-binding Protein HMf-2, Recombinant, Methanothermus fervidus, aa1-69, His-Tag
• Biozol Catalog Number: USB-584288
• Supplier Catalog Number: 584288
• Alternative Catalog Number: USB-584288-20,USB-584288-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Binds and compacts DNA (95 to 150 base pairs) to form nucleosome-like structures that contain positive DNA supercoils. Increases the resistance of DNA to thermal denaturation in vitro. Source: Recombinant protein corresponding to aa1-69 from Methanothermus fervidus DNA-binding protein HMf-2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.7kD Amino Acid Sequence: MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 9.7
• UniProt: P19267
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.