This inhibitor is composed of two homologous actively inhibiting halves: one which inhibits trypsin, the other which inhibits elastase. Source: Recombinant protein corresponding to aa1-115 from canine Double-headed protease inhibitor, submandibular gland, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~17.8kD Amino Acid Sequence: GPPPAIGREVDCSNYKGKGSQIACPRLHQPICGTDHKTYSNECMFCALTLNKKFEVRKLQDTACDIECTEYSDMCTMDYRPLCGSDGKNYSNKCSFCNAVKKSRGTIFLAKHGEC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
