E3 Ubiquitin-protein Ligase ZNRF3, Recombinant, Human, aa56-219, His-Tag

Catalog Number: USB-584341
Article Name: E3 Ubiquitin-protein Ligase ZNRF3, Recombinant, Human, aa56-219, His-Tag
Biozol Catalog Number: USB-584341
Supplier Catalog Number: 584341
Alternative Catalog Number: USB-584341-20,USB-584341-100
Manufacturer: US Biological
Category: Molekularbiologie
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification. Source: Recombinant protein corresponding to aa56-219 from human E3 ubiquitin-protein ligase ZNRF3, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~19.7kD Amino Acid Sequence: KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19.7
UniProt: Q9ULT6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.