Ecotin, Recombinant, E. coli O127:H6, aa21-162, His-Tag, Myc-Tag

Catalog Number: USB-584344
Article Name: Ecotin, Recombinant, E. coli O127:H6, aa21-162, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584344
Supplier Catalog Number: 584344
Alternative Catalog Number: USB-584344-20,USB-584344-100
Manufacturer: US Biological
Category: Molekularbiologie
General inhibitor of pancreatic serine proteases: inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases. Source: Recombinant protein corresponding to aa21-162 from Escherichia coli O127:H6 Ecotin, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~23.5kD Amino Acid Sequence: AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLESKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.5
UniProt: B7UFM3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.