Electron Transfer Flavoprotein-ubiquinone Oxidoreductase, Recombinant, Paracoccus denitrificans, aa1-31, His-KSI-Tag

Catalog Number: USB-584360
Article Name: Electron Transfer Flavoprotein-ubiquinone Oxidoreductase, Recombinant, Paracoccus denitrificans, aa1-31, His-KSI-Tag
Biozol Catalog Number: USB-584360
Supplier Catalog Number: 584360
Alternative Catalog Number: USB-584360-20,USB-584360-100
Manufacturer: US Biological
Category: Molekularbiologie
Accepts electrons from ETF and reduces ubiquinone. Source: Recombinant protein corresponding to aa1-31 from Paracoccus denitrificans Electron transfer flavoprotein-ubiquinone oxidoreductase, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.4kD Amino Acid Sequence: SDIGGSMDYDVVIVGAGGAGLSAAILKQVNP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.4
UniProt: P55932
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.