Endochitinase B, Recombinant, Zea mays, aa21-269, His-Tag, Myc-Tag

Catalog Number: USB-584364
Article Name: Endochitinase B, Recombinant, Zea mays, aa21-269, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584364
Supplier Catalog Number: 584364
Alternative Catalog Number: USB-584364-20,USB-584364-100
Manufacturer: US Biological
Category: Molekularbiologie
Defense against chitin-containing fungal pathogens. Source: Recombinant protein corresponding to aa21-269 from Zea mays Endochitinase B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~33.8kD Amino Acid Sequence: QNCGCQPNVCCSKFGYCGTTDEYCGDGCQSGPCRSGRGGGGSGGGGANVASVVTSSFFNGIKNQAGSGCEGKNFYTRSAFLSAVKGYPGFAHGGSQVQGKREIAAFFAHATHETGHFCYISEINKSNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAVVAFKAALWFWMNSVHGVVPQGFGATTRAMQRALECGGNNPAQMNARVGYYRQYCRQLGVDPGPNLTC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33.8
UniProt: P29023
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.