Enterotoxin Type A, Recombinant, Staphylococcus aureus, aa25-253, His-Tag
Biozol Catalog Number:
USB-584389
Supplier Catalog Number:
584389
Alternative Catalog Number:
USB-584389-20,USB-584389-100,USB-584389-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, waves of cellular activation, cytokine production, and migration into the lung tissue and airways occur via alphabeta T-cells. Causes also the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death (Probable). Partial recombinant protein corresponding to aa25-253 from Staphylococcus aureus Enterotoxin type A, fused to 6X His-Tag at N-terminal, expressed in E.coli. Swiss/Uniprot: P0A0L2 Molecular Weight: ~30.5kD Amino Acid Sequence: SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted