Envelope Protein p54, Recombinant, African Swine Fever Virus, aa73-160, His-Tag

Product Overview

• Article Name: Envelope Protein p54, Recombinant, African Swine Fever Virus, aa73-160, His-Tag
• Biozol Catalog Number: USB-584423
• Supplier Catalog Number: 584423
• Alternative Catalog Number: USB-584423-20,USB-584423-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Envelope protein involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward viral factories. Seems to induce caspase-3 activation and apoptosis. Plays a role in virion morphogenesis by recruiting and transforming the host ER membranes into the precursors of the viral envelope. Source: Recombinant protein corresponding to aa73-160 from African swine fever virus Envelope protein p54, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~14.9kD Amino Acid Sequence: PYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 14.9
• UniProt: Q65272
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.