Erythropoietin Receptor, Recombinant, Rat, aa25-249, His-SUMO-Tag, His-Tag

Catalog Number: USB-584451
Article Name: Erythropoietin Receptor, Recombinant, Rat, aa25-249, His-SUMO-Tag, His-Tag
Biozol Catalog Number: USB-584451
Supplier Catalog Number: 584451
Alternative Catalog Number: USB-584451-20,USB-584451-100
Manufacturer: US Biological
Category: Molekularbiologie
Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate LYN tyrosine kinase. Source: Recombinant protein corresponding to aa25-249 from rat Erythropoietin receptor, fused to 6X His-SUMO-Tag at N-terminal 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~39.1kD Amino Acid Sequence: ASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.1
UniProt: Q07303
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.