ESAT-6 Secretion System Extracellular Protein A, Recombinant, Staphylococcus aureus, aa1-97, His-SUMO-Tag

Catalog Number: USB-584461
Article Name: ESAT-6 Secretion System Extracellular Protein A, Recombinant, Staphylococcus aureus, aa1-97, His-SUMO-Tag
Biozol Catalog Number: USB-584461
Supplier Catalog Number: 584461
Alternative Catalog Number: USB-584461-20,USB-584461-100
Manufacturer: US Biological
Category: Molekularbiologie
Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity. Source: Recombinant protein corresponding to aa1-97 from Staphylococcus aureus ESAT-6 secretion system extracellular protein A, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.0kD Amino Acid Sequence: MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27
UniProt: Q6GCJ0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.