Exopolyphosphatase, Recombinant, Saccharomyces cerevisiae, aa1-397, His-Tag

Catalog Number: USB-584478
Article Name: Exopolyphosphatase, Recombinant, Saccharomyces cerevisiae, aa1-397, His-Tag
Biozol Catalog Number: USB-584478
Supplier Catalog Number: 584478
Alternative Catalog Number: USB-584478-20,USB-584478-100
Manufacturer: US Biological
Category: Molekularbiologie
Degradation of inorganic polyphosphates. Source: Recombinant protein corresponding to aa1-397 from Saccharomyces cerevisiae Exopolyphosphatase, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~47.1kD Amino Acid Sequence: MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.1
UniProt: P38698
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.