Exotoxin A Regulatory Protein, Recombinant, Pseudomonas aeruginosa, aa1-259, His-KSI-Tag

Catalog Number: USB-584479
Article Name: Exotoxin A Regulatory Protein, Recombinant, Pseudomonas aeruginosa, aa1-259, His-KSI-Tag
Biozol Catalog Number: USB-584479
Supplier Catalog Number: 584479
Alternative Catalog Number: USB-584479-20,USB-584479-100
Manufacturer: US Biological
Category: Molekularbiologie
Positive regulation of toxA gene transcription. Source: Recombinant protein corresponding to aa1-259 from Pseudomonas aeruginosa Exotoxin A regulatory protein, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~44.2kD Amino Acid Sequence: MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFSSPAC Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.2
UniProt: P09852
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, pH 8.0, 50% glycerol