Extracellular Serine/threonine Protein Kinase FAM20C, Recombinant, Human, aa354-565, His-Tag, Myc-Tag
Biozol Catalog Number:
USB-584486
Supplier Catalog Number:
584486
Alternative Catalog Number:
USB-584486-20,USB-584486-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Source: Recombinant protein corresponding to aa354-565 from human Extracellular serine/threonine protein kinase FAM20C, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~29.9kD Amino Acid Sequence: FISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVERNG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted