Family with Sequence Similarity 19 (Chemokine (C-C motif)-like), Member A5a, Recombinant, Danio rerio, aa43-131, His-Tag

Catalog Number: USB-584502
Article Name: Family with Sequence Similarity 19 (Chemokine (C-C motif)-like), Member A5a, Recombinant, Danio rerio, aa43-131, His-Tag
Biozol Catalog Number: USB-584502
Supplier Catalog Number: 584502
Alternative Catalog Number: USB-584502-20,USB-584502-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa43-131 from Danio rerio Family with sequence similarity 19 (chemokine (C-C motif)-like), member A5a, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.8kD Amino Acid Sequence: TCEIVTLDKDSSQPRRTIARQTARCACKKGQIAGTTNARPACVDARIVKTKQWCDMVPCLEDEECDLLVNKSGWTCTQPSGRVKTTTVS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.8
UniProt: A2BIC8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.