Fatty Acid-binding Protein, Heart, Recombinant, Rat, aa2-133, His-Tag

Product Overview

• Article Name: Fatty Acid-binding Protein, Heart, Recombinant, Rat, aa2-133, His-Tag
• Biozol Catalog Number: USB-584505
• Supplier Catalog Number: 584505
• Alternative Catalog Number: USB-584505-20,USB-584505-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. Source: Recombinant protein corresponding to aa2-133 from rat Fatty acid-binding protein, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~18.6kD Amino Acid Sequence: ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 18.6
• UniProt: P07483
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.