Fatty Acid-binding Protein, Liver, Recombinant, Human, aa1-127, His-Tag

Catalog Number: USB-584506
Article Name: Fatty Acid-binding Protein, Liver, Recombinant, Human, aa1-127, His-Tag
Biozol Catalog Number: USB-584506
Supplier Catalog Number: 584506
Alternative Catalog Number: USB-584506-20,USB-584506-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. Source: Recombinant protein corresponding to aa1-127 from human Fatty acid-binding protein, liver, fused to 6X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~16.2kD Amino Acid Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.2
UniProt: P07148
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.