Fc Receptor-like Protein 6, Recombinant, Human, aa20-307, His-Tag

Product Overview

• Article Name: Fc Receptor-like Protein 6, Recombinant, Human, aa20-307, His-Tag
• Biozol Catalog Number: USB-584510
• Supplier Catalog Number: 584510
• Alternative Catalog Number: USB-584510-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Acts as a MHC class II receptor Source: Recombinant protein corresponding to aa20-307 from human Fc receptor-like protein 6, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~34.2kD Amino Acid Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 34.2
• UniProt: Q6DN72
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.