Fc Receptor-like Protein 6, Recombinant, Human, aa20-307, His-Tag
Biozol Catalog Number:
USB-584511
Supplier Catalog Number:
584511
Alternative Catalog Number:
USB-584511-20
Manufacturer:
US Biological
Category:
Molekularbiologie
Acts as a MHC class II receptor. When stimulated on its own, does not play a role in cytokine production or the release of cytotoxic granules by NK cells and cytotoxic CD8(+) T cells. Does not act as an Fc receptor. Recombinant protein corresponding to aa20-307 from human Fc receptor-like protein 6, fused to 10X His-Tag at N-terminal, expressed in Mammalian cell. Swiss/UniProt Accession: Q6DN72. Molecular Weight: ~35.2kD Amino Acid Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
