Fe/S Biogenesis Protein NfuA, Recombinant, E. coli, aa1-191, GST-Tag

Product Overview

• Article Name: Fe/S Biogenesis Protein NfuA, Recombinant, E. coli, aa1-191, GST-Tag
• Biozol Catalog Number: USB-584512
• Supplier Catalog Number: 584512
• Alternative Catalog Number: USB-584512-20,USB-584512-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. Source: Recombinant protein corresponding to aa1-191 from Escherichia coli Fe/S biogenesis protein NfuA, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.7kD Amino Acid Sequence: MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 47.7
• UniProt: B1X760
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.