Fe/S Biogenesis Protein NfuA, Recombinant, E. coli, aa1-191, His-Tag
Biozol Catalog Number:
USB-584513
Supplier Catalog Number:
584513
Alternative Catalog Number:
USB-584513-20,USB-584513-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. Source: Recombinant protein corresponding to aa1-191 from Escherichia coli Fe/S biogenesis protein NfuA, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.1kD Amino Acid Sequence: MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted