Ferric Uptake Regulation Protein, Recombinant, E. coli, aa2-148, His-Tag
Biozol Catalog Number:
USB-584517
Supplier Catalog Number:
584517
Alternative Catalog Number:
USB-584517-20,USB-584517-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Acts as a global negative controlling element, employing Fe(2+) as a cofactor to bind the operator of the repressed genes. Regulates the expression of several outer-membrane proteins including the iron transport operon. Source: Recombinant protein corresponding to aa2-148 from Escherichia coli Ferric uptake regulation protein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.7kD Amino Acid Sequence: TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted