Fibroblast Growth Factor 2, Recombinant, Human, aa143-288, His-SUMO-Tag

Catalog Number: USB-584529
Article Name: Fibroblast Growth Factor 2, Recombinant, Human, aa143-288, His-SUMO-Tag
Biozol Catalog Number: USB-584529
Supplier Catalog Number: 584529
Alternative Catalog Number: USB-584529-20,USB-584529-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis. Source: Recombinant protein corresponding to aa143-288 from human Fibroblast growth factor 2, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.4kD Amino Acid Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.4
UniProt: P09038
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.