Fimbrial Protein 1, Recombinant, Moraxella bovis, aa7-159, HIs-SUMO-Tag

Product Overview

• Article Name: Fimbrial Protein 1, Recombinant, Moraxella bovis, aa7-159, HIs-SUMO-Tag
• Biozol Catalog Number: USB-584550
• Supplier Catalog Number: 584550
• Alternative Catalog Number: USB-584550-20,USB-584550-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa7-159 from Moraxella bovis Fimbrial protein 1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~29.0kD Amino Acid Sequence: FTLIELMIVIAIIGILAAIALPAYQDYISKSQTTRVSGELAAGKTAVDAALFEGKTPVLSEESSTSKENIGLTSSETSTKPRSNLMASVELTGFADNGAGTISATLGNKANKDIAKTVITQERTTDGVWTCKIDGSQAAKYKEKFNPTGCVKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 29
• UniProt: P20657
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.