Fimbrial Protein 1, Recombinant, Moraxella bovis, aa7-159, His-SUMOSTAR-Tag

Catalog Number: USB-584551
Article Name: Fimbrial Protein 1, Recombinant, Moraxella bovis, aa7-159, His-SUMOSTAR-Tag
Biozol Catalog Number: USB-584551
Supplier Catalog Number: 584551
Alternative Catalog Number: USB-584551-20,USB-584551-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa7-159 from Moraxella bovis Fimbrial protein 1, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.2kD Amino Acid Sequence: FTLIELMIVIAIIGILAAIALPAYQDYISKSQTTRVSGELAAGKTAVDAALFEGKTPVLSEESSTSKENIGLTSSETSTKPRSNLMASVELTGFADNGAGTISATLGNKANKDIAKTVITQERTTDGVWTCKIDGSQAAKYKEKFNPTGCVKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.2
UniProt: P20657
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.