Fin Bud Initiation Factor, Recombinant, Danio rerio, aa24-210, His-Tag, Myc-Tag

Catalog Number: USB-584557
Article Name: Fin Bud Initiation Factor, Recombinant, Danio rerio, aa24-210, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584557
Supplier Catalog Number: 584557
Alternative Catalog Number: USB-584557-20,USB-584557-100
Manufacturer: US Biological
Category: Molekularbiologie
Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle. Source: Recombinant protein corresponding to aa24-210 from Danio rerio Fin bud initiation factor, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~26.9kD Amino Acid Sequence: FFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.9
UniProt: A1IGX5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.