Frataxin, Mitochondrial, Recombinant, Human, aa1-210, His-SUMO-Tag, Myc-Tag

Catalog Number: USB-584576
Article Name: Frataxin, Mitochondrial, Recombinant, Human, aa1-210, His-SUMO-Tag, Myc-Tag
Biozol Catalog Number: USB-584576
Supplier Catalog Number: 584576
Alternative Catalog Number: USB-584576-20,USB-584576-100
Manufacturer: US Biological
Category: Molekularbiologie
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+), the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization, however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1. Source: Recombinant protein corresponding to aa22-245 from human Frataxin, mitochondrial, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~43.1kD Amino Acid Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 43.1
UniProt: Q16595
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.