Gamma-synuclein, Recombinant, Rat, aa1-123, His-Tag

Product Overview

• Article Name: Gamma-synuclein, Recombinant, Rat, aa1-123, His-Tag
• Biozol Catalog Number: USB-584623
• Supplier Catalog Number: 584623
• Alternative Catalog Number: USB-584623-20,USB-584623-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. Source: Recombinant protein corresponding to aa1-123 from rat Gamma-synuclein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.1kD Amino Acid Sequence: MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 17.1
• UniProt: Q63544
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.