Gap Junction alpha-1 Protein, Recombinant Mouse, aa232-382, His-Tag, Myc-Tag

Product Overview

• Article Name: Gap Junction alpha-1 Protein, Recombinant Mouse, aa232-382, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-584625
• Supplier Catalog Number: 584625
• Alternative Catalog Number: USB-584625-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Negative regulator of bladder functional capacity. Source: Recombinant protein corresponding to aa232-382 from mouse Gap junction alpha-1 protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~20.3kD Amino Acid Sequence: FFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.3
• UniProt: P23242
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.