Gap Junction alpha-1 Protein, Recombinant, Human, aa233-382, His-Tag

Catalog Number: USB-584626
Article Name: Gap Junction alpha-1 Protein, Recombinant, Human, aa233-382, His-Tag
Biozol Catalog Number: USB-584626
Supplier Catalog Number: 584626
Alternative Catalog Number: USB-584626-20
Manufacturer: US Biological
Category: Molekularbiologie
Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity. Source: Recombinant protein corresponding to aa22-138 from human Gap junction alpha-1 protein, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~18.8kD Amino Acid Sequence: FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.8
UniProt: P17302
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.