Gap Junction Alpha-1 Protein, Recombinant, Mouse, aa232-382, His-Myc-Tag

Catalog Number: USB-584628
Article Name: Gap Junction Alpha-1 Protein, Recombinant, Mouse, aa232-382, His-Myc-Tag
Biozol Catalog Number: USB-584628
Supplier Catalog Number: 584628
Alternative Catalog Number: USB-584628-20,USB-584628-100
Manufacturer: US Biological
Category: Molekularbiologie
Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles., Connexin 43 is possibly the ATP-induced pore of mouse macrophages. Source: Recombinant protein corresponding to aa232-382 from mouse Gap junction alpha-1 protein, fused to 6X His-Myc-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.1kD Amino Acid Sequence: FFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.1
UniProt: P23242
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.