Genome Polyprotein, Recombinant, Bovine Viral Diarrhea Virus, aa1-168, His-Tag

Catalog Number: USB-584647
Article Name: Genome Polyprotein, Recombinant, Bovine Viral Diarrhea Virus, aa1-168, His-Tag
Biozol Catalog Number: USB-584647
Supplier Catalog Number: 584647
Alternative Catalog Number: USB-584647-20,USB-584647-100
Manufacturer: US Biological
Category: Molekularbiologie
Leader cysteine autoprotease that cleaves itself from the nascent polyprotein during translation of the viral mRNA. Once released, plays a role in the inhibition of host innate immune response by interacting with host IRF3 and inducing its proteasomal degradation., Packages viral RNA to form a viral nucleocapsid and thereby protects viral RNA. Plays also a role in transcription regulation. Protects the incoming virus against IFN-induced effectors., Initial binding to target cell probably involves interaction of E(rns) with glycosaminoglycans., E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis., E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis., Plays an essential role in the virus replication cycle by acting as a viroporin. Forms ion conductive pores, which alters the cell permeability allowing the transport of ions and other small molecules. Forms a leader sequence to properly orient NS2 in the membrane., Uncleaved NS2-3 is required for production of infectious virus., Plays a role in the regulation of viral RNA replication., Multifunctional protein that contains an N-terminal protease and a C-terminal helicase, playing essential roles in viral polyprotein processing and viral genome replication. The chymotrypsin-like serine protease activity utilizes NS4A as an essential cofactor and catalyzes the cleavage of the polyprotein leading to the release of NS4A, NS4B, NS5A, and NS5B. Interacts with NS5B to enhance RNA-dependent RNA polymerase activity., Acts as a cofactor for the NS3 protease activity., Induces a specific membrane alteration that serves as a scaffold for the virus replication complex., Replicates the viral (+) and (-) genome. Source: Recombinant protein corresponding to aa1-168 from Bovine viral diarrhea virus Genome polyprotein, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.4kD Amino Acid Sequence: MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.4
UniProt: Q01499
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.