Source: Recombinant protein corresponding to aa1441-1497 from Enterovirus A71 Genome polyprotein, fused to GST-Tag, expressed in E.coli. Molecular Weight: ~33.9kD Amino Acid Sequence: GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
