GEO11329p1, Recombinant, Drosophila melanogaster, aa33-119, hFC-Myc-Tag

Catalog Number: USB-584661
Article Name: GEO11329p1, Recombinant, Drosophila melanogaster, aa33-119, hFC-Myc-Tag
Biozol Catalog Number: USB-584661
Supplier Catalog Number: 584661
Alternative Catalog Number: USB-584661-20,USB-584661-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa33-119 from Drosophila melanogaster GEO11329p1, fused to hFC-Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~39.2kD Amino Acid Sequence: SNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQHFLRVVNGSPISFNMGPQT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.2
UniProt: Q9W151
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.