Glucagon-like Peptide 1 Receptor, Recombinant, Rat, aa22-135, His-Tag

Catalog Number: USB-584674
Article Name: Glucagon-like Peptide 1 Receptor, Recombinant, Rat, aa22-135, His-Tag
Biozol Catalog Number: USB-584674
Supplier Catalog Number: 584674
Alternative Catalog Number: USB-584674-20,USB-584674-100
Manufacturer: US Biological
Category: Molekularbiologie
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Source: Recombinant protein corresponding to aa22-135 from rat Glucagon-like peptide 1 receptor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.1kD Amino Acid Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.1
UniProt: P32301
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.