Glutamate Receptor ionotropic, NMDA, Recombinant, Human, aa834-938, His-Tag

Catalog Number: USB-584683
Article Name: Glutamate Receptor ionotropic, NMDA, Recombinant, Human, aa834-938, His-Tag
Biozol Catalog Number: USB-584683
Supplier Catalog Number: 584683
Alternative Catalog Number: USB-584683-20,USB-584683-100
Manufacturer: US Biological
Category: Molekularbiologie
Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+). Source: Recombinant protein corresponding to aa834-938 from human Glutamate receptor ionotropic, NMDA, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.0kD Amino Acid Sequence: EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18
UniProt: Q05586
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.