Glutathione Peroxidase-like Peroxiredoxin 2, Recombinant, Saccharomyces cerevisiae, aa1-162, His-Tag

Catalog Number: USB-584691
Article Name: Glutathione Peroxidase-like Peroxiredoxin 2, Recombinant, Saccharomyces cerevisiae, aa1-162, His-Tag
Biozol Catalog Number: USB-584691
Supplier Catalog Number: 584691
Alternative Catalog Number: USB-584691-20,USB-584691-100
Manufacturer: US Biological
Category: Molekularbiologie
Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress. Plays an important role in the oxidative stress-induced response in the presence of Ca(2+). Has peroxidase activity using preferentially thioredoxin as a reducing power. The redox state of the mitochondrial GPX2 is regulated by TRX1 and TRX2 (cytoplasmic thioredoxin), and by TRX3 (mitochondrial matrix thioredoxin). Involved in sporulation. Source: Recombinant protein corresponding to aa1-162 from Saccharomyces cerevisiae Glutathione peroxidase-like peroxiredoxin 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~22.5kD Amino Acid Sequence: MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.5
UniProt: P38143
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.