Glutathione S-transferase, Recombinant, Blattella germanica, aa2-204, His-Tag

Catalog Number: USB-584698
Article Name: Glutathione S-transferase, Recombinant, Blattella germanica, aa2-204, His-Tag
Biozol Catalog Number: USB-584698
Supplier Catalog Number: 584698
Alternative Catalog Number: USB-584698-20,USB-584698-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa2-204 from Blattella germanica Glutathione S-transferase, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.2kD Amino Acid Sequence: APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.2
UniProt: O18598
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.